PDB entry 6dw1

View 6dw1 on RCSB PDB site
Description: Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric GABAA receptor in complex with GABA (ECD map)
Class: membrane protein
Keywords: Neurotransmission, GABA Receptors, GABA, Cys Loop Receptors, Ion Channel, MEMBRANE PROTEIN
Deposited on 2018-06-26, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gabra1, Gabra-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor subunit beta-1,Gamma-aminobutyric acid receptor subunit beta-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gabrb1, Gabrb-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dw1b_
  • Chain 'C':
    Compound: Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gabra1, Gabra-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gamma-aminobutyric acid receptor subunit gamma-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: GABRG2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Gamma-aminobutyric acid receptor subunit beta-1,Gamma-aminobutyric acid receptor subunit beta-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gabrb1, Gabrb-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dw1e_
  • Heterogens: NAG, BMA, MAN, ABU

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dw1B (B:)
    mwtvqnreslgllsfpvmvamvccahssnepsnmsyvketvdrllkgydirlrpdfggpp
    vdvgmridvasidmvsevnmdytltmyfqqswkdkrlsysgiplnltldnrvadqlwvpd
    tyflndkksfvhgvtvknrmirlhpdgtvlyglritttaacmmdlrrypldeqnctleie
    sygyttddiefywnggegavtgvnkielpqfsivdykmvskkvefttgayprlslsfrlk
    rnigyfilqtympstlitilswvsfwinydasaarvalgittvltmttisthlretlpki
    pyvkaidiylmgcfvfvflalleyafvnyiffggtipdltdvnsidkwsrmffpitfslf
    nvvywlyyvhlvprgshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dw1B (B:)
    nmsyvketvdrllkgydirlrpdfggppvdvgmridvasidmvsevnmdytltmyfqqsw
    kdkrlsysgiplnltldnrvadqlwvpdtyflndkksfvhgvtvknrmirlhpdgtvlyg
    lritttaacmmdlrrypldeqnctleiesygyttddiefywnggegavtgvnkielpqfs
    ivdykmvskkvefttgayprlslsfrlkrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dw1E (E:)
    mwtvqnreslgllsfpvmvamvccahssnepsnmsyvketvdrllkgydirlrpdfggpp
    vdvgmridvasidmvsevnmdytltmyfqqswkdkrlsysgiplnltldnrvadqlwvpd
    tyflndkksfvhgvtvknrmirlhpdgtvlyglritttaacmmdlrrypldeqnctleie
    sygyttddiefywnggegavtgvnkielpqfsivdykmvskkvefttgayprlslsfrlk
    rnigyfilqtympstlitilswvsfwinydasaarvalgittvltmttisthlretlpki
    pyvkaidiylmgcfvfvflalleyafvnyiffggtipdltdvnsidkwsrmffpitfslf
    nvvywlyyvhlvprgshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dw1E (E:)
    syvketvdrllkgydirlrpdfggppvdvgmridvasidmvsevnmdytltmyfqqswkd
    krlsysgiplnltldnrvadqlwvpdtyflndkksfvhgvtvknrmirlhpdgtvlyglr
    itttaacmmdlrrypldeqnctleiesygyttddiefywnggegavtgvnkielpqfsiv
    dykmvskkvefttgayprlslsfrlkrn