PDB entry 6dv4

View 6dv4 on RCSB PDB site
Description: HIV-1 wild type protease with GRL-04315A, a tetrahydronaphthalene carboxamide with (R)-Boc-amine and (S)-hydroxyl functionalities as the P2 ligand
Class: hydrolase, antiviral protein
Keywords: aspartic acid protease, HIV-1 protease inhibitor of GRL-04315A, tetrahydronaphthalene carboxamide, P2 ligand, drug resistance, design and synthesis, HYDROLASE, ANTIVIRAL PROTEIN
Deposited on 2018-06-22, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d6dv4a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5RZ08 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d6dv4b_
  • Heterogens: GA5, NA, CL, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dv4A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dv4B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf