PDB entry 6duv

View 6duv on RCSB PDB site
Description: Crystal structure of the second bromodomain of human BRD4 in complex with MS417 inhibitor
Class: PROTEIN BINDING/Inhibitor
Keywords: protein-small molecule inhibitor complex, PROTEIN BINDING, PROTEIN BINDING-Inhibitor complex
Deposited on 2018-06-22, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6duva_
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6duvb_
  • Heterogens: 0S6, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6duvA (A:)
    sskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksk
    leareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6duvA (A:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6duvB (B:)
    sskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksk
    leareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6duvB (B:)
    vseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksklea
    reyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmp