PDB entry 6dur

View 6dur on RCSB PDB site
Description: Citrobacter freundii tyrosine phenol-lyase complexed with L-phenylalanine
Class: lyase
Keywords: pyridoxal-5'-phosphate, aminotransferase fold, LYASE
Deposited on 2018-06-21, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: TPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (0-454)
      • conflict (203)
    Domains in SCOPe 2.08: d6dura_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Gene: TPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31013 (0-454)
      • conflict (203)
    Domains in SCOPe 2.08: d6durb_
  • Heterogens: P71, K, PGE, P33, P70, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6durA (A:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6durA (A:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvhhrpkletvrltiprrvytyahmdvvadgi
    iklyqhkedirglkfiyepkqlrfftarfdyi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6durB (B:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlrfftarfdyi