PDB entry 6dun

View 6dun on RCSB PDB site
Description: Crystal Structure Analysis of PIN1
Class: isomerase
Keywords: prolyl isomerase, ISOMERASE
Deposited on 2018-06-21, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-121)
      • engineered mutation (35)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6duna_
  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-121)
      • engineered mutation (35)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d6dunb_
  • Heterogens: TAS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dunA (A:)
    gshmkngqgeparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgee
    dfeslasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilr
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dunA (A:)
    qgeparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgeedfeslas
    qfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dunB (B:)
    gshmkngqgeparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgee
    dfeslasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilr
    te
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dunB (B:)
    geparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgeedfeslasq
    fsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte