PDB entry 6duk

View 6duk on RCSB PDB site
Description: EGFR with an allosteric inhibitor
Class: transferase/transferase inhibitor
Keywords: Allosteric inhibitor, EGFR, ONCOPROTEIN, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-06-21, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d6duka_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d6dukb_
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d6dukc_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d6dukd_
  • Chain 'E':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d6duke_
  • Chain 'F':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
      • engineered mutation (256)
    Domains in SCOPe 2.07: d6dukf_
  • Heterogens: MG, ANP, JBJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dukA (A:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dukA (A:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
    malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
    idvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyra
    lmdeed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dukB (B:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dukB (B:)
    pnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkanke
    ildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriy
    thqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcw
    midadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dukC (C:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dukC (C:)
    pnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkanke
    ildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dukD (D:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dukD (D:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
    malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
    idvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyra
    lmdeedm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dukE (E:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dukE (E:)
    apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank
    eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw
    cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhr
    iythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrk
    cwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dukF (F:)
    gstsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dukF (F:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgavpikwmalesilhriy
    thqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcw
    midadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmdd