PDB entry 6duj

View 6duj on RCSB PDB site
Description: Crystal structure of A51V variant of Human Cytochrome c
Class: apoptosis
Keywords: peroxidase activity, heme, APOPTOSIS
Deposited on 2018-06-20, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • variant (50)
    Domains in SCOPe 2.07: d6duja_
  • Chain 'C':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • variant (50)
    Domains in SCOPe 2.07: d6dujc_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dujA (A:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytavnknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dujC (C:)
    gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytavnknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne