PDB entry 6dtw

View 6dtw on RCSB PDB site
Description: HIV-1 Reverse Transcriptase Y181C Mutant in complex with JLJ 578
Class: hydrolase, transferase/inhibitor
Keywords: HIV-1, reverse transcriptase, inhibitor, HYDROLASE, TRANSFERASE-INHIBITOR complex
Deposited on 2018-06-18, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reverse transcriptase/ribonuclease H
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (2-End)
      • expression tag (0-1)
      • engineered mutation (173-174)
      • engineered mutation (182)
      • engineered mutation (281)
    Domains in SCOPe 2.07: d6dtwa1, d6dtwa2, d6dtwa3
  • Chain 'B':
    Compound: p51 RT
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (Start-427)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d6dtwb_
  • Heterogens: H9Y, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dtwA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdi
    vicqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtwA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfairklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrk
    ytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivicqymdd
    lyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivl
    pekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaen
    reilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvk
    qlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklw
    yqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylal
    qdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggne
    qvdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dtwB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtwB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfr
    kytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymd
    dlyvgsdleigqhrtkieelrqhllrwgyelhpdkwtvqpivlpekdswtvndiqklvgk
    lnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhgvyydpsk
    dliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviw
    gktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq