PDB entry 6dtu

View 6dtu on RCSB PDB site
Description: Maltotetraose bound T. maritima MalE1
Class: sugar binding protein
Keywords: periplasmic binding protein, maltose binding protein, maltotetraose, SUGAR BINDING PROTEIN
Deposited on 2018-06-18, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein MalE1
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_1204
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0T1 (1-373)
      • initiating methionine (0)
      • expression tag (374)
    Domains in SCOPe 2.07: d6dtua1, d6dtua2
  • Chain 'B':
    Compound: maltose-binding protein MalE1
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_1204
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0T1 (1-373)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6dtub_
  • Heterogens: MTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dtuA (A:)
    mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiiv
    gahdwvgelavngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyv
    peppktmdelieiakqideefggevrgfitsaaefyyiapfifgyggyvfkqtekgldvn
    diglanegaikgvkllkrlvdegildpsdnyqimdsmfregqaamiingpwaikaykdag
    idygvapipdlepgvparpfvgvqgfmvnakspnkllaiefltsfiakketmyriylgdp
    rlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamndalnlvvngkatvee
    alknaverikaqiqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dtuB (B:)
    mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiiv
    gahdwvgelavngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyv
    peppktmdelieiakqideefggevrgfitsaaefyyiapfifgyggyvfkqtekgldvn
    diglanegaikgvkllkrlvdegildpsdnyqimdsmfregqaamiingpwaikaykdag
    idygvapipdlepgvparpfvgvqgfmvnakspnkllaiefltsfiakketmyriylgdp
    rlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamndalnlvvngkatvee
    alknaverikaqiqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtuB (B:)
    mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiiv
    gahdwvgelavngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyv
    peppktmdelieiakqideefggevrgfitsaaefyyiapfifgyggyvfkqtekgldvn
    diglanegaikgvkllkrlvdegildpsdnyqimdsmfregqaamiingpwaikaykdag
    idygvapipdlepgvparpfvgvqgfmvnakspnkllaiefltsfiakketmyriylgdp
    rlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamndalnlvvngkatvee
    alknaverikaqiq