PDB entry 6dtt

View 6dtt on RCSB PDB site
Description: Apo T. maritima MalE2
Class: sugar binding protein
Keywords: periplasmic binding protein, maltose binding protein, maltotetraose, SUGAR BINDING PROTEIN
Deposited on 2018-06-18, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein MalE2
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_1839
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtta_
  • Chain 'B':
    Compound: maltose-binding protein MalE2
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_1839
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dttb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dttA (A:)
    mqtkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiiv
    gahdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyv
    dsvpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvt
    diglanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdag
    inygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladp
    rlparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasved
    alkeavekikaqiekgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dttA (A:)
    tkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivga
    hdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvds
    vpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdi
    glanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdagin
    ygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladprl
    parkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasvedal
    keavekikaqiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dttB (B:)
    mqtkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiiv
    gahdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyv
    dsvpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvt
    diglanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdag
    inygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladp
    rlparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasved
    alkeavekikaqiekgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dttB (B:)
    qtkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivg
    ahdwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvd
    svpktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtd
    iglanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdagi
    nygvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladpr
    lparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasveda
    lkeavekikaqiek