PDB entry 6dtr

View 6dtr on RCSB PDB site
Description: Apo T. maritima MalE3
Class: sugar binding protein
Keywords: periplasmic binding protein, maltose binding protein, maltotetraose, SUGAR BINDING PROTEIN
Deposited on 2018-06-18, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein MalE3
    Species: Thermotoga maritima [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dtra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dtrA (A:)
    mavkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaaget
    dpdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdagll
    yyrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfg
    gdvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrn
    wpyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklik
    fltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevs
    dviqryvhaaltrqttsedaikniakelkfllgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtrA (A:)
    avkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaagetd
    pdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdaglly
    yrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfgg
    dvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrnw
    pyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklikf
    ltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevsd
    viqryvhaaltrqttsedaikniakelkfllgq