PDB entry 6dtq

View 6dtq on RCSB PDB site
Description: Maltose bound T. maritima MalE3
Class: sugar binding protein
Keywords: periplasmic binding protein, maltose binding protein, maltotetraose, SUGAR BINDING PROTEIN
Deposited on 2018-06-18, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein MalE3
    Species: Thermotoga maritima [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtqa_
  • Chain 'B':
    Compound: maltose-binding protein MalE3
    Species: Thermotoga maritima [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtqb_
  • Chain 'C':
    Compound: maltose-binding protein MalE3
    Species: Thermotoga maritima [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtqc_
  • Chain 'D':
    Compound: maltose-binding protein MalE3
    Species: Thermotoga maritima [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtqd_
  • Heterogens: MAL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dtqA (A:)
    mavkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaaget
    dpdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdagll
    yyrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfg
    gdvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrn
    wpyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklik
    fltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevs
    dviqryvhaaltrqttsedaikniakelkfllgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtqA (A:)
    avkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaagetd
    pdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdaglly
    yrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfgg
    dvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrnw
    pyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklikf
    ltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevsd
    viqryvhaaltrqttsedaikniakelkfll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dtqB (B:)
    mavkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaaget
    dpdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdagll
    yyrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfg
    gdvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrn
    wpyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklik
    fltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevs
    dviqryvhaaltrqttsedaikniakelkfllgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtqB (B:)
    avkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaagetd
    pdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdaglly
    yrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfgg
    dvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrnw
    pyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklikf
    ltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevsd
    viqryvhaaltrqttsedaikniakelkfll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dtqC (C:)
    mavkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaaget
    dpdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdagll
    yyrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfg
    gdvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrn
    wpyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklik
    fltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevs
    dviqryvhaaltrqttsedaikniakelkfllgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtqC (C:)
    avkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaagetd
    pdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdaglly
    yrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfgg
    dvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrnw
    pyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklikf
    ltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevsd
    viqryvhaaltrqttsedaikniakelkfll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dtqD (D:)
    mavkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaaget
    dpdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdagll
    yyrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfg
    gdvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrn
    wpyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklik
    fltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevs
    dviqryvhaaltrqttsedaikniakelkfllgqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtqD (D:)
    avkitmtsggvgkelevlkkqlemfhqqypdieveiipmpdssterhdlyvtyfaagetd
    pdvlmldviwpaefapfledltadkdyfelgeflpgtvmsvtvngrivavpwftdaglly
    yrkdllekygydhaprtwdelvemakkisqaegihgfvwqgaryeglvcdfleylwsfgg
    dvldesgkvvidspeavaalqfmvdliykhkvtpegvttymeedarrifqngeavfmrnw
    pyawslvnsdespikgkvgvaplpmgpggrraatlggwvlginkfsspeekeaakklikf
    ltsydqqlykainagqnptrkavykdpklkeaapfmvellgvfinalprprvanytevsd
    viqryvhaaltrqttsedaikniakelkfll