PDB entry 6dtl

View 6dtl on RCSB PDB site
Description: Mitogen-activated protein kinase 6
Class: transferase
Keywords: Kinase, plant protein, TRANSFERASE
Deposited on 2018-06-17, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 6
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MPK6, At2g43790, F18O19.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtla_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 6
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MPK6, At2g43790, F18O19.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dtlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dtlA (A:)
    gienipatlshggrfiqynifgnifevtakykppimpigkgaygivcsamnsetnesvai
    kkianafdnkidakrtlreikllrhmdhenivairdiippplrnafndvyiayelmdtdl
    hqiirsnqalseehcqyflyqilrglkyihsanvlhrdlkpsnlllnancdlkicdfgla
    rvtsesdfmteyvvtrwyrapelllnssdytaaidvwsvgcifmelmdrkplfpgrdhvh
    qlrllmeligtpseeeleflnenakryirqlppyprqsitdkfptvhplaidliekmltf
    dprrritvldalahpylnslhdisdepectipfnfdfenhalseeqmkeliyrealafnp
    eyqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtlA (A:)
    gienipatlshggrfiqynifgnifevtakykppimpigkgaygivcsamnsetnesvai
    kkianafdnkidakrtlreikllrhmdhenivairdiippplrnafndvyiayelmdtdl
    hqiirsnqalseehcqyflyqilrglkyihsanvlhrdlkpsnlllnancdlkicdfgla
    rvtsevtrwyrapelllnssdytaaidvwsvgcifmelmdrkplfpgrdhvhqlrllmel
    igtpseeeleflnenakryirqlppyprqsitdkfptvhplaidliekmltfdprrritv
    ldalahpylnslhdisdepectipfnfdfenhalseeqmkeliyrealafnpeyqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dtlB (B:)
    gienipatlshggrfiqynifgnifevtakykppimpigkgaygivcsamnsetnesvai
    kkianafdnkidakrtlreikllrhmdhenivairdiippplrnafndvyiayelmdtdl
    hqiirsnqalseehcqyflyqilrglkyihsanvlhrdlkpsnlllnancdlkicdfgla
    rvtsesdfmteyvvtrwyrapelllnssdytaaidvwsvgcifmelmdrkplfpgrdhvh
    qlrllmeligtpseeeleflnenakryirqlppyprqsitdkfptvhplaidliekmltf
    dprrritvldalahpylnslhdisdepectipfnfdfenhalseeqmkeliyrealafnp
    eyqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtlB (B:)
    ienipatlshggrfiqynifgnifevtakykppimpigkgaygivcsamnsetnesvaik
    kianafdnkidakrtlreikllrhmdhenivairdiippplrnafndvyiayelmdtdlh
    qiirsnqalseehcqyflyqilrglkyihsanvlhrdlkpsnlllnancdlkicdfglsd
    fmteyvvtrwyrapelllnssdytaaidvwsvgcifmelmdrkplfpgrdhvhqlrllme
    ligtpseeeleflnenakryirqlppyprqsitdkfptvhplaidliekmltfdprrrit
    vldalahpylnslhdisdepectipfnfdfenhalseeqmkeliyrealafnpeyqq