PDB entry 6dtk

View 6dtk on RCSB PDB site
Description: Heterodimers of FALS mutant SOD enzyme
Class: oxidoreductase
Keywords: Copper/Zinc superoxide dismutase Cu, Zn-SOD1, metal binding protein, FALS Zn-deficient SOD1, OXIDOREDUCTASE
Deposited on 2018-06-17, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase C111S/D83S-C111S HETERODIMER
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • microheterogeneity (83)
      • engineered mutation (111)
      • linker (154-155)
      • linker (166-169)
    • Uniprot P00441 (170-322)
      • microheterogeneity (252)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d6dtka1, d6dtka2
  • Chain 'C':
    Compound: Superoxide dismutase C111S/D83S-C111S HETERODIMER
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • microheterogeneity (83)
      • engineered mutation (111)
      • linker (154)
      • linker (166-169)
    • Uniprot P00441 (170-322)
      • microheterogeneity (252)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d6dtkc1, d6dtkc2
  • Chain 'E':
    Compound: Superoxide dismutase C111S/D83S-C111S HETERODIMER
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • microheterogeneity (83)
      • engineered mutation (111)
      • linker (154-156)
      • linker (166-169)
    • Uniprot P00441 (170-322)
      • microheterogeneity (252)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d6dtke1, d6dtke2
  • Chain 'G':
    Compound: Superoxide dismutase C111S/D83S-C111S HETERODIMER
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • microheterogeneity (83)
      • engineered mutation (111)
      • linker (154-156)
      • linker (166-169)
    • Uniprot P00441 (170-322)
      • microheterogeneity (252)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d6dtkg1, d6dtkg2
  • Chain 'I':
    Compound: Superoxide dismutase C111S/D83S-C111S HETERODIMER
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-153)
      • microheterogeneity (83)
      • engineered mutation (111)
      • linker (154-156)
      • linker (166-169)
    • Uniprot P00441 (170-322)
      • microheterogeneity (252)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d6dtki1, d6dtki2
  • Heterogens: ZN, CU, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dtkA (A:)
    matkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaqgaaasgggggsggggsatkavcvlkg
    dgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrk
    hggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkgg
    neestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtkA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaqgagggsatkavcvlkgdgpvqgiinfe
    qkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrkhggpkdeerhv
    gslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggneestktgnag
    srlacgvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dtkC (C:)
    matkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaqgaaasgggggsggggsatkavcvlkg
    dgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrk
    hggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkgg
    neestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtkC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaqggggsatkavcvlkgdgpvqgiinfeq
    kesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrkhggpkdeerhvg
    slgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggneestktgnags
    rlacgvigiaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dtkE (E:)
    matkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaqgaaasgggggsggggsatkavcvlkg
    dgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrk
    hggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkgg
    neestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtkE (E:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaqgaagggsatkavcvlkgdgpvqgiinf
    eqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrkhggpkdeerh
    vgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggneestktgna
    gsrlacgvigiaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dtkG (G:)
    matkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaqgaaasgggggsggggsatkavcvlkg
    dgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrk
    hggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkgg
    neestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtkG (G:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaqgaagggsatkavcvlkgdgpvqgiinf
    eqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrkhggpkdeerh
    vgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggneestktgna
    gsrlacgvigiaq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6dtkI (I:)
    matkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagcts
    agphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvv
    hekaddlgkggneestktgnagsrlacgvigiaqgaaasgggggsggggsatkavcvlkg
    dgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrk
    hggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkgg
    neestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dtkI (I:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaqgaagggsatkavcvlkgdgpvqgiinf
    eqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsrkhggpkdeerh
    vgslgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhekaddlgkggneestktgna
    gsrlacgvigiaq