PDB entry 6dt4

View 6dt4 on RCSB PDB site
Description: 1.8 Angstrom Resolution Crystal Structure of cAMP-Regulatory Protein from Yersinia pestis in Complex with cAMP
Class: DNA binding protein
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, DNA-binding, cAMP, DNA BINDING PROTEIN
Deposited on 2018-06-15, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic AMP receptor protein
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: crp, y3956, YP_0174
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dt4a1, d6dt4a2
  • Chain 'B':
    Compound: Cyclic AMP receptor protein
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: crp, y3956, YP_0174
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dt4b1, d6dt4b2
  • Heterogens: CMP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dt4A (A:)
    snamvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeeg
    kemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrl
    ssqmanrlqitsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqiv
    gcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dt4A (A:)
    pqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyl
    nqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlssqmanrl
    qitsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvg
    rilkmledqnlisahgktivvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dt4B (B:)
    snamvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeeg
    kemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrl
    ssqmanrlqitsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqiv
    gcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dt4B (B:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlssqmanrlqit
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvyg