PDB entry 6dsp

View 6dsp on RCSB PDB site
Description: LsrB from Clostridium saccharobutylicum in complex with AI-2
Class: signaling protein
Keywords: AI-2 receptor, SIGNALING PROTEIN
Deposited on 2018-06-14, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding protein lsrB
    Species: Clostridium saccharobutylicum DSM 13864 [TaxId:1345695]
    Gene: lsrB, CLSA_c21430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dspa_
  • Chain 'B':
    Compound: Autoinducer 2-binding protein lsrB
    Species: Clostridium saccharobutylicum DSM 13864 [TaxId:1345695]
    Gene: lsrB, CLSA_c21430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dspb_
  • Heterogens: PAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dspA (A:)
    gsftssntttdtstnsskkgnvtvtfipkltgnaffesankgaqkyseqwgfkvdyegda
    nasaasqvsvinkavqqgtnaiclssvdaagvkdalkaaadagvtvttwdsdvdpsvrkv
    mvsqgtpeqlgqmlvqmgydslkergkdpekdaikycwhysnatvtdqnswqvegekyik
    skypnwqnvapdnyysnqdaeqaisvgesilsahsdidliicndstalpgqaqaaqnkgl
    taknvtitgfaspnsmkqycndgiltrwglwdcgiqgamgcymayyiasgnsvkvgdkie
    iptvgtvevmpnsvldpkaddsdtssgvvllpertiftkdnmnnydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dspA (A:)
    vtvtfipkltgnaffesankgaqkyseqwgfkvdyegdanasaasqvsvinkavqqgtna
    iclssvdaagvkdalkaaadagvtvttwdsdvdpsvrkvmvsqgtpeqlgqmlvqmgyds
    lkergkdpekdaikycwhysnatvtdqnswqvegekyikskypnwqnvapdnyysnqdae
    qaisvgesilsahsdidliicndstalpgqaqaaqnkgltaknvtitgfaspnsmkqycn
    dgiltrwglwdcgiqgamgcymayyiasgnsvkvgdkieiptvgtvevmpnsvldpkadd
    sdtssgvvllpertiftkdnmnnydf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dspB (B:)
    gsftssntttdtstnsskkgnvtvtfipkltgnaffesankgaqkyseqwgfkvdyegda
    nasaasqvsvinkavqqgtnaiclssvdaagvkdalkaaadagvtvttwdsdvdpsvrkv
    mvsqgtpeqlgqmlvqmgydslkergkdpekdaikycwhysnatvtdqnswqvegekyik
    skypnwqnvapdnyysnqdaeqaisvgesilsahsdidliicndstalpgqaqaaqnkgl
    taknvtitgfaspnsmkqycndgiltrwglwdcgiqgamgcymayyiasgnsvkvgdkie
    iptvgtvevmpnsvldpkaddsdtssgvvllpertiftkdnmnnydf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dspB (B:)
    vtvtfipkltgnaffesankgaqkyseqwgfkvdyegdanasaasqvsvinkavqqgtna
    iclssvdaagvkdalkaaadagvtvttwdsdvdpsvrkvmvsqgtpeqlgqmlvqmgyds
    lkergkdpekdaikycwhysnatvtdqnswqvegekyikskypnwqnvapdnyysnqdae
    qaisvgesilsahsdidliicndstalpgqaqaaqnkgltaknvtitgfaspnsmkqycn
    dgiltrwglwdcgiqgamgcymayyiasgnsvkvgdkieiptvgtvevmpnsvldpkadd
    sdtssgvvllpertiftkdnmnnydf