PDB entry 6dsi

View 6dsi on RCSB PDB site
Description: Anti recombinant prolactin receptor scFv
Class: immune system
Keywords: anti prolactin receptor scFV, IMMUNE SYSTEM
Deposited on 2018-06-14, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-TN-C scFv
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DSI (0-End)
    Domains in SCOPe 2.07: d6dsia1, d6dsia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dsiA (A:)
    evqllesggglvqpggslrlscaasgfrfyaedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakrgygsgafdywgqgtlvtvssg
    gggsggggsggggstdiqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapk
    lliygasnlqsgvpsrfsgsgsgtdftltisslqpedfatyycqqdsylpytfgqgtkve
    ik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dsiA (A:)
    evqllesggglvqpggslrlscaasgfrfyaedmgwvrqapgkglewvssiygpsgstyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakrgygsgafdywgqgtlvtvsgg
    gstdiqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliygasnlqsg
    vpsrfsgsgsgtdftltisslqpedfatyycqqdsylpytfgqgtkvei