PDB entry 6ds7

View 6ds7 on RCSB PDB site
Description: Crystal structure of MhuD R26S mutant with two hemes bound per active site
Class: oxidoreductase
Keywords: Heme Oxygenase (decyclizing) Activity, Monooxygenase Activity, Oxidoreductase Activity, Heme Binding, Metal Ion Binding, Heme Catabolic Process, Oxidation Reduction Process, Cell Wall, Plasma Membrane, OXIDOREDUCTASE
Deposited on 2018-06-13, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme-degrading monooxygenase HmoB
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: mhuD, Rv3592
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WKH3 (0-98)
      • engineered mutation (24)
    Domains in SCOPe 2.08: d6ds7a_
  • Chain 'B':
    Compound: Heme-degrading monooxygenase HmoB
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: mhuD, Rv3592
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WKH3 (0-98)
      • engineered mutation (24)
    Domains in SCOPe 2.08: d6ds7b_
  • Heterogens: HEM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ds7A (A:)
    pvvkinaievpagagpelekrfahsahavenspgflgfqllrpvkgeeryfvvthwesde
    afqawangpaiaahaghranpvatgasllefevvldvgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ds7B (B:)
    pvvkinaievpagagpelekrfahsahavenspgflgfqllrpvkgeeryfvvthwesde
    afqawangpaiaahaghranpvatgasllefevvldvgg