PDB entry 6ds6

View 6ds6 on RCSB PDB site
Description: Crystal structure of p300 ZZ domain in complex with histone H3 peptide
Class: GENE REGULATION, Transferase
Keywords: p300, ZZ domain, histone, chromatin, GENE REGULATION, Transferase
Deposited on 2018-06-13, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H3 peptide-Histone acetyltransferase p300 Chimeric protein
  Species: Homo sapiens [TaxId:9606]
  Gene: EP300, P300
  Database cross-references and differences (RAF-indexed):
  • PDB 6DS6 (0-5)
  • Uniprot Q09472 (6-End)
  Domains in SCOPe 2.08: d6ds6a_
• Heterogens: ZN, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ds6A (A:)
  artkqtqdrfvytcneckhhvetrwhctvcedydlcitcyntknhdhkmeklglgld
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ds6A (A:)
  artkqtqdrfvytcneckhhvetrwhctvcedydlcitcyntknhdhkmeklg