PDB entry 6ds2

View 6ds2 on RCSB PDB site
Description: Crystal structure of Ni(II)-bound human calprotectin
Class: metal binding protein
Keywords: S100, nickel, sodium, EF-hand, METAL BINDING PROTEIN
Deposited on 2018-06-13, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d6ds2a_
  • Chain 'B':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ds2b_
  • Chain 'C':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d6ds2c_
  • Chain 'D':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ds2d_
  • Chain 'E':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d6ds2e_
  • Chain 'F':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ds2f_
  • Chain 'G':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d6ds2g_
  • Chain 'H':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ds2h_
  • Heterogens: NI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ds2A (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2A (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ds2B (B:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2B (B:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ds2C (C:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2C (C:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ds2D (D:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2D (D:)
    msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
    dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ds2E (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2E (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ds2F (F:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2F (F:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ds2G (G:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2G (G:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ds2H (H:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds2H (H:)
    kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
    edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgeg