PDB entry 6ds1

View 6ds1 on RCSB PDB site
Description: Crystal structure of Cj0485 dehydrogenase in complex with NADP+
Class: oxidoreductase
Keywords: dehydrogenase, OXIDOREDUCTASE
Deposited on 2018-06-13, released 2019-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: Cj0485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ds1a_
  • Chain 'B':
    Compound: Putative oxidoreductase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: Cj0485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ds1b_
  • Chain 'C':
    Compound: Putative oxidoreductase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: Cj0485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ds1c_
  • Chain 'D':
    Compound: Putative oxidoreductase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: Cj0485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ds1d_
  • Heterogens: NAP, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ds1A (A:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwdentrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds1A (A:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldraln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ds1B (B:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwdentrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds1B (B:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ds1C (C:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwdentrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds1C (C:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ds1D (D:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwdentrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ds1D (D:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnw