PDB entry 6drr

View 6drr on RCSB PDB site
Description: Crystal structure of Cj0485 dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-06-12, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0L11_03550, BKM79_02435, CRM98_01005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6drra_
  • Chain 'B':
    Compound: Short-chain dehydrogenase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: A0L11_03550, BKM79_02435, CRM98_01005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6drrb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6drrA (A:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwdentrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6drrA (A:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6drrB (B:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwdentrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6drrB (B:)
    mdlkiknkvciitggakgigygiaklwaseggipvifsrsmpkehdkelkklsseyefye
    idlknyeqieklvkkvaikhggiyalvnnagtndnlhientstqdliksyennlfhyytm
    tkeclpyikkeqgsilnivsktgitgqgrtsayasakaaqmgftrewacafakdnvrvna
    iapaevmtplyekwlqnfpnpkeqyekiakaiplghrfttieeiantavftlsplashtt
    gqilmpdggyvhldralnwd