PDB entry 6drg

View 6drg on RCSB PDB site
Description: NMR solution structure of wild type hFABP1 with GW7647
Class: lipid binding protein
Keywords: hLFABP, GW7647, LIPID BINDING PROTEIN
Deposited on 2018-06-11, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (8-134)
      • expression tag (0-7)
    Domains in SCOPe 2.07: d6drga1, d6drga2
  • Heterogens: 2VN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6drgA (A:)
    hhhhhhvamsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
    tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
    mtlgdivfkriskri