PDB entry 6dr8

View 6dr8 on RCSB PDB site
Description: Metallo-beta-lactamase from Cronobacter sakazakii (Enterobacter sakazakii) HARLDQ motif mutant S60/R118H/Q121H/K254H
Class: hydrolase
Keywords: Metallo-beta-lactamse, METAL BINDING PROTEIN, Beta-lactamase, HYDROLASE
Deposited on 2018-06-11, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Cronobacter sakazakii [TaxId:28141]
    Gene: CSK29544_03680
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6VWC7 (Start-259)
      • engineered mutation (74)
      • engineered mutation (77)
      • engineered mutation (210)
    Domains in SCOPe 2.07: d6dr8a_
  • Heterogens: PO4, ZN, 1KA, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dr8A (A:)
    slfeawakpvqpfaiwpgvwyvgtenlssvllttpqghilidagldasapqirrniealg
    frmadiryianshahldhaggiarlkawsgarviashanaeqmarggkedfalgdalpfp
    pvtvdmeaqdgqqwhlggvtlaaiftpghlpgatswkvtladgktliyadslatpgypli
    nnrnyptlvedirrsfarleaqqvdiflanhgerfglmdkmarkargennafidkaglar
    yvaqsraafekqlaaqraqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dr8A (A:)
    pvqpfaiwpgvwyvgtenlssvllttpqghilidagldasapqirrniealgfrmadiry
    ianshahldhaggiarlkawsgarviashanaeqmarggkedfalgdalpfppvtvdmea
    qdgqqwhlggvtlaaiftpghlpgatswkvtladgktliyadslatpgyplinnrnyptl
    vedirrsfarleaqqvdiflanhgerfglmdkmarkargennafidkaglaryvaqsraa
    fekqlaaqraqp