PDB entry 6dqg

View 6dqg on RCSB PDB site
Description: Human glutamate dehydrogenase, H454Y mutant
Class: oxidoreductase
Keywords: Glutamate, dehydrogenase, insulin, hyperinsulinism, OXIDOREDUCTASE
Deposited on 2018-06-10, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD1, GLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00367 (0-495)
      • engineered mutation (444)
    Domains in SCOPe 2.07: d6dqga1, d6dqga2
  • Chain 'B':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD1, GLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00367 (0-495)
      • engineered mutation (444)
    Domains in SCOPe 2.07: d6dqgb1, d6dqgb2
  • Chain 'C':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD1, GLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00367 (0-495)
      • engineered mutation (444)
    Domains in SCOPe 2.07: d6dqgc1, d6dqgc2
  • Chain 'D':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD1, GLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00367 (0-495)
      • engineered mutation (444)
    Domains in SCOPe 2.07: d6dqgd1, d6dqgd2
  • Chain 'E':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD1, GLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00367 (0-495)
      • engineered mutation (444)
    Domains in SCOPe 2.07: d6dqge1, d6dqge2
  • Chain 'F':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD1, GLUD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00367 (0-495)
      • engineered mutation (444)
    Domains in SCOPe 2.07: d6dqgf1, d6dqgf2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dqgA (A:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivysglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dqgB (B:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivysglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dqgC (C:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivysglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dqgD (D:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivysglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dqgE (E:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivysglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dqgF (F:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivysglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft