PDB entry 6dq2

View 6dq2 on RCSB PDB site
Description: Cronobacter sakazakii (Enterobacter sakazakii) Metallo-beta-lactamse HARLDQ motif mutant S60
Class: hydrolase
Keywords: Metallo-beta-lactamse, METAL BINDING PROTEIN, Beta-lactamase, HYDROLASE
Deposited on 2018-06-10, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Cronobacter sakazakii [TaxId:28141]
    Gene: CSK29544_03680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dq2a_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dq2A (A:)
    mkprialfsclmsllsvpahaaldpaqplaeappyslfeawakpvqpfaiwpgvwyvgte
    nlssvllttpqghilidagldasapqirrniealgfrmadiryiansharldqaggiarl
    kawsgarviashanaeqmarggkedfalgdalpfppvtvdmeaqdgqqwhlggvtlaaif
    tpghlpgatswkvtladgktliyadslatpgyplinnrnyptlvedirrsfarleaqqvd
    iflankgerfglmdkmarkargennafidkaglaryvaqsraafekqlaaqraqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dq2A (A:)
    feawakpvqpfaiwpgvwyvgtenlssvllttpqghilidagldasapqirrniealgfr
    madiryiansharldqaggiarlkawsgarviashanaeqmarggkedfalgdalpfppv
    tvdmeaqdgqqwhlggvtlaaiftpghlpgatswkvtladgktliyadslatpgyplinn
    rnyptlvedirrsfarleaqqvdiflankgerfglmdkmarkargennafidkaglaryv
    aqsraafekqlaaqraqp