PDB entry 6do6

View 6do6 on RCSB PDB site
Description: NMR solution structure of wild type apo hFABP1 at 308 K
Class: lipid binding protein
Keywords: lipid binding protein
Deposited on 2018-06-09, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, liver
  Species: Homo sapiens [TaxId:9606]
  Gene: FABP1, FABPL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07148 (8-134)
    • expression tag (0-7)
  Domains in SCOPe 2.08: d6do6a1, d6do6a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6do6A (A:)
  hhhhhhvamsfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkfti
  tagskviqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitnt
  mtlgdivfkriskri