PDB entry 6do2

View 6do2 on RCSB PDB site
Description: Crystal structure of human GRP78 in complex with 7-deaza-2'-C-methyladenosine
Class: chaperone, hydrolase
Keywords: human GRP78, adenosine analog, chaperone, hydrolase
Deposited on 2018-06-08, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6do2a1, d6do2a2
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6do2b1, d6do2b2
  • Heterogens: H5V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6do2A (A:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6do2B (B:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg