PDB entry 6dnz

View 6dnz on RCSB PDB site
Description: Trypanosoma brucei PRMT1 enzyme-prozyme heterotetrameric complex with AdoHcy
Class: gene regulation
Keywords: protein arginine methyltransferase, prozyme, teterameric complex, PRMT1, GENE REGULATION
Deposited on 2018-06-08, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine N-methyltransferase, putative
    Species: Trypanosoma brucei brucei TREU927 [TaxId:185431]
    Gene: TB927.1.4690
    Database cross-references and differences (RAF-indexed):
    • PDB 6DNZ (Start-344)
    Domains in SCOPe 2.07: d6dnza_
  • Chain 'B':
    Compound: Arginine N-methyltransferase, putative
    Species: Trypanosoma brucei brucei TREU927 [TaxId:185431]
    Gene: Tb10.70.3860
    Database cross-references and differences (RAF-indexed):
    • PDB 6DNZ (Start-390)
  • Chain 'C':
    Compound: Arginine N-methyltransferase, putative
    Species: Trypanosoma brucei brucei TREU927 [TaxId:185431]
    Gene: TB927.1.4690
    Database cross-references and differences (RAF-indexed):
    • PDB 6DNZ (Start-344)
    Domains in SCOPe 2.07: d6dnzc_
  • Chain 'D':
    Compound: Arginine N-methyltransferase, putative
    Species: Trypanosoma brucei brucei TREU927 [TaxId:185431]
    Gene: Tb10.70.3860
    Database cross-references and differences (RAF-indexed):
    • PDB 6DNZ (Start-390)
  • Heterogens: SAH, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dnzA (A:)
    mtvdanaasstttttdyyfdsyshygihmemlkdchrttsyrdamwrnaylfkdkvvldv
    gcgtgilsmfaakagarkvigvdcstvavqareivkdngfedvitiiqgkveeiqldekv
    diiisewmgyfllyesmlntvlcardnlgtpdvkmfpdkanmhvcgitdeqyiqerfniw
    dnvqgidfsyfkrlsfieplvdtversqivtnvaplvsfdintvkeadlsftsefaleaq
    asrgkrnggnsiiyvhalsvhfdtpftaghevvildttpysppthwrqtvlylfnplrmr
    ageratfrmkcspnalngrdldislhvdfegalqishydqdfrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnzA (A:)
    dsyshygihmemlkdchrttsyrdamwrnaylfkdkvvldvgcgtgilsmfaakagarkv
    igvdcstvavqareivkdngfedvitiiqgkveeiqldekvdiiisewmgyfllyesmln
    tvlcardnlgtpdvkmfpdkanmhvcgitdeqyiqerfniwdnvqgidfsyfkrlsfiep
    lvdtversqivtnvaplvsfdintvkeadlsftsefaleaqasiiyvhalsvhfdtpfta
    ghevvildttpysppthwrqtvlylfnplrmrageratfrmkcspnalngrdldislhvd
    fegalqishydqdfrlr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dnzC (C:)
    mtvdanaasstttttdyyfdsyshygihmemlkdchrttsyrdamwrnaylfkdkvvldv
    gcgtgilsmfaakagarkvigvdcstvavqareivkdngfedvitiiqgkveeiqldekv
    diiisewmgyfllyesmlntvlcardnlgtpdvkmfpdkanmhvcgitdeqyiqerfniw
    dnvqgidfsyfkrlsfieplvdtversqivtnvaplvsfdintvkeadlsftsefaleaq
    asrgkrnggnsiiyvhalsvhfdtpftaghevvildttpysppthwrqtvlylfnplrmr
    ageratfrmkcspnalngrdldislhvdfegalqishydqdfrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnzC (C:)
    dsyshygihmemlkdchrttsyrdamwrnaylfkdkvvldvgcgtgilsmfaakagarkv
    igvdcstvavqareivkdngfedvitiiqgkveeiqldekvdiiisewmgyfllyesmln
    tvlcardnlgtpdvkmfpdkanmhvcgitdeqyiqerfniwdnvqgidfsyfkrlsfiep
    lvdtversqivtnvaplvsfdintvkeadlsftsefaleaqasiiyvhalsvhfdtpfta
    ghevvildttpysppthwrqtvlylfnplrmrageratfrmkcspnalngrdldislhvd
    fegalqishydqdfrlr
    

  • Chain 'D':
    No sequence available.