PDB entry 6dnt

View 6dnt on RCSB PDB site
Description: UDP-N-acetylglucosamine 4-epimerase from Methanobrevibacter ruminantium M1 in complex with UDP-N-acetylmuramic acid
Class: sugar binding protein
Keywords: UDP-N-acetylglucosamine, WbpP, 4-epimerase, UDP-N-acetylmuramic acid, SUGAR BINDING PROTEIN
Deposited on 2018-06-07, released 2018-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.6600000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent epimerase/dehydratase
    Species: Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) [TaxId:634498]
    Gene: mru_1413
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dnta_
  • Heterogens: NAD, EPZ, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dntA (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftmkdknvvvtgglgfigshivdaliddn
    kvtiidnlssgkmenlnnpnhenltiikedlmdadlekilkdkdyvfhlaalasvpgsva
    eplrynqnnidaslklfiacknnnikkvifssssavygenpnmplkesenflpcspyaaq
    kascelylksfhesygldyvalryfnvfgprqdenspyaavipkfisailngespviygd
    geqsrdfiyvkeiakanilsaesdyngvinvalgksmtinrlfeiisdvlesdidvkyld
    erpgdikhsladisnldkisfkpdedkfeeqlretvkwfisqme
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dntA (A:)
    mkdknvvvtgglgfigshivdaliddnkvtiidnlssgkmenlnnpnhenltiikedlmd
    adlekilkdkdyvfhlaalasvpgsvaeplrynqnnidaslklfiacknnnikkvifsss
    savygenpnmplkesenflpcspyaaqkascelylksfhesygldyvalryfnvfgprqd
    enspyaavipkfisailngespviygdgeqsrdfiyvkeiakanilsaesdyngvinval
    gksmtinrlfeiisdvlesdidvkylderpgdikhsladisnldkisfkpdedkfeeqlr
    etvkwfisqm