PDB entry 6dnq

View 6dnq on RCSB PDB site
Description: HBZ77 in complex with KIX and c-Myb
Class: transcription
Keywords: transcription coactivator, transcription factor, viral, eukaryotic, complex, TRANSCRIPTION
Deposited on 2018-06-07, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator Myb
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dnqb_
  • Chain 'C':
    Compound: Transcriptional activator Myb
    Species: Mus musculus [TaxId:10090]
    Gene: Myb
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dnqd_
  • Chain 'E':
    Compound: BZIP factor
    Species: Human T-lymphotropic virus 1 [TaxId:11908]
    Gene: HBZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2Q067 (4-End)
      • conflict (10)
      • conflict (15)
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dnqB (B:)
    mgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesan
    srdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnqB (B:)
    gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
    rdeyyhllaekiykiqkeleekrrsrl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dnqD (D:)
    mgvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesan
    srdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnqD (D:)
    gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
    rdeyyhllaekiykiqkeleekrrsrl
    

  • Chain 'E':
    No sequence available.