PDB entry 6dnk

View 6dnk on RCSB PDB site
Description: Human Stimulator of Interferon Genes
Class: immune system
Keywords: human STING, complex, 2', 3'-cGAMP, TMEM173, Ala230 allelle, 230A/232R, IMMUNE SYSTEM
Deposited on 2018-06-06, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TMEM173, ERIS, MITA, STING
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86WV6 (0-End)
      • conflict (76)
      • conflict (78)
    Domains in SCOPe 2.07: d6dnka_
  • Heterogens: 1SY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dnkA (A:)
    nvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnls
    madpnirfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsq
    ysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrhl
    rqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dnkA (A:)
    nvahglawsyyigylrlilpelqarirtynqhyavsqrlyillpldcgvpdnlsmadpni
    rfldklpqqtadragikdrvysnsiyellengqragtcvleyatplqtlfamsqysqagf
    sredrleqaklfcrtlediladapesqnncrliayqepasfslsqevlrhlrq