PDB entry 6dmh

View 6dmh on RCSB PDB site
Description: A multiconformer ligand model of acylenzyme intermediate of meropenem bound to an SFC-1 E166A mutant
Class: hydrolase/hydrolase inhibitor
Keywords: Complex, multi conformer model, antibiotic, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-06-05, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Serratia fonticola [TaxId:47917]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6JP75 (0-269)
      • engineered mutation (144)
      • conflict (232)
      • conflict (247)
    Domains in SCOPe 2.07: d6dmha_
  • Heterogens: MER, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dmhA (A:)
    asqppqvtvdklkrlendfggrigvyaidtgsnktfgyranerfplcssfkgflaaavls
    ksqqqegllnqrirydnrvmephspvtekqittgmtvaelsaatlqysdngaanlllekl
    iggpegmtsfmrsigdnvfrldrwalelnsaipgddrdtstpkavaesmqklafgnvlgl
    terhqlmdwfkgnttggarirasvpanwvvgdktgtcgvygtandyaviwpvahapivla
    vytskpdrnskhsdaviadasrivlesfni