PDB entry 6dmg

View 6dmg on RCSB PDB site
Description: A multiconformer ligand model of EK6 bound to ERK2
Class: transferase/transferase inhibitor
Keywords: Complex, multiconformer model, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-06-05, released 2018-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6dmga_
  • Heterogens: EK6, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dmgA (A:)
    pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
    eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
    yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
    rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
    dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
    pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg