PDB entry 6dlb

View 6dlb on RCSB PDB site
Description: Crystal Structure of an influenza A hemagglutinin antibody Fab CH65:1203d4 chimera
Class: immune system
Keywords: Influenza A virus, hemagglutinin, antibody, antibody design, rosetta, IMMUNE SYSTEM
Deposited on 2018-05-31, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CH65:1203d4 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DLB (0-End)
  • Chain 'L':
    Compound: CH65:1203d4 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DLB
    Domains in SCOPe 2.07: d6dlbl1, d6dlbl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6dlbL (L:)
    qsvltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkanptvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dlbL (L:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkanptvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt