PDB entry 6dkw

View 6dkw on RCSB PDB site
Description: Crystal structure of Trk-A in complex with the Pan-Trk Kinase Inhibitor, compound 3.
Class: transferase/transferase inhibitor
Keywords: Inhibitor Tyrosine kinase, TRANSFERASE, pan-Trk Kinase, Treatment for pain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-05-31, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot J3KP20 (13-End)
      • initiating methionine (0)
      • expression tag (1-12)
    Domains in SCOPe 2.07: d6dkwa_
  • Chain 'B':
    Compound: tyrosine-protein kinase receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot J3KP20 (13-End)
      • expression tag (7-12)
    Domains in SCOPe 2.07: d6dkwb1, d6dkwb2
  • Heterogens: GXA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dkwA (A:)
    mhhhhhhlvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalke
    asesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpda
    kllaggedvapgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigd
    fgmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpw
    yqlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqap
    pvyldvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkwA (A:)
    mhhhhhhlvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalke
    asesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpda
    kllaggedgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgl
    pirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgrelerp
    racppevyaimrgcwqrepqqrhsikdvharlqalaqappvyld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dkwB (B:)
    mhhhhhhlvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalke
    asesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpda
    kllaggedvapgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigd
    fgmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpw
    yqlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqap
    pvyldvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkwB (B:)
    lvprgsvhhikrrdivlkwelgegkvflaechnllpeqdkmlvavkalkeasesarqdfq
    reaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakgplglgqll
    avasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgtmlpirwmppesilyrkf
    ttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgrelerpracppevyaimrgcw
    qrepqqrhsikdvharlqalaqappvyld