PDB entry 6dku

View 6dku on RCSB PDB site
Description: Crystal structure of Myotis VP35 mutant of interferon inhibitory domain
Class: unknown function
Keywords: unknown function
Deposited on 2018-05-30, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp35
    Species: Myotis lucifugus [TaxId:59463]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9JKD1 (3-116)
      • variant (7)
      • variant (17)
      • variant (35)
      • variant (55)
      • variant (69)
      • variant (82)
      • engineered mutation (92)
      • variant (94)
      • engineered mutation (96)
    • PDB 6DKU (117-127)
    Domains in SCOPe 2.07: d6dkua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dkuA (A:)
    ghmrlpldptefvrvltgyltgprtafhelvsaiamvsrdshdlqvamdhfnrelmdgfs
    ahaaiisitqrceyfrnceapttqvtsksqiprayhrrlrdvpegpktlgrgwvyiyltp
    egslglki
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkuA (A:)
    rlpldptefvrvltgyltgprtafhelvsaiamvsrdshdlqvamdhfnrelmdgfsaha
    aiisitqrceyfrnceapttqvtsksqiprayhrrlrdvpegpktlgrgwvyiyltpegs
    lglki