PDB entry 6dkj

View 6dkj on RCSB PDB site
Description: human GIPR ECD and Fab complex
Class: signaling protein
Keywords: gpcr, signaling protein
Deposited on 2018-05-29, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DKJ (0-108)
    • Uniprot P0DOX5 (109-End)
  • Chain 'B':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HEL-213
    Database cross-references and differences (RAF-indexed):
    • PDB 6DKJ (0-93)
    • Uniprot V9HW34 (94-End)
    Domains in SCOPe 2.07: d6dkjb1, d6dkjb2
  • Chain 'C':
    Compound: Gastric inhibitory polypeptide receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GIPR
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gastric inhibitory polypeptide receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: GIPR
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DKJ (0-108)
    • Uniprot P0DOX5 (109-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HEL-213
    Database cross-references and differences (RAF-indexed):
    • PDB 6DKJ (0-93)
    • Uniprot V9HW34 (94-End)
    Domains in SCOPe 2.07: d6dkjl1, d6dkjl2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dkjB (B:)
    eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygaatratgipa
    rvsgsgsgteftltisslqsedfavyycqqynnwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkjB (B:)
    eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygaatratgipa
    rvsgsgsgteftltisslqsedfavyycqqynnwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6dkjL (L:)
    eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygaatratgipa
    rvsgsgsgteftltisslqsedfavyycqqynnwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkjL (L:)
    eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygaatratgipa
    rvsgsgsgteftltisslqsedfavyycqqynnwpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge