PDB entry 6dke

View 6dke on RCSB PDB site
Description: The X-ray crystal structure of Streptococcus pneumoniae Fatty Acid Kinase (Fak) B1 protein loaded with palmitic acid (C16:0) to 1.76 Angstrom resolution
Class: transferase
Keywords: Streptococcus pneumoniae, Fatty acid kinase, oleic acid, TRANSFERASE
Deposited on 2018-05-29, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty Acid Kinase (Fak) B1 protein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DP17 (34-315)
      • expression tag (33)
    Domains in SCOPe 2.07: d6dkea1, d6dkea2
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dkeA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrdpmklavftdssaylsaetlqredlfvl
    dipvnidgeeyveginlsaeefyqkmaqaselpktsqpsiakldeiltslkeqgythalg
    lflssgisgfyqsiqymvddyegltiafpdtlitsaplgimvesvfnwrdqgddfasiqd
    klaiqisrtsafimvddldhlvkggrlsngaailgnllsikpilyfndqgvievyekvrt
    ekkatkrlieiikettasgqyrvivihgnapekaeelrqhlldfglgsdvslatfgsvig
    thlgagsialgyipvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkeA (A:)
    pmklavftdssaylsaetlqredlfvldipvnidgeeyveginlsaeefyqkmaqaselp
    ktsqpsiakldeiltslkeqgythalglflssgisgfyqsiqymvddyegltiafpdtli
    tsaplgimvesvfnwrdqgddfasiqdklaiqisrtsafimvddldhlvkggrlsngaai
    lgnllsikpilyfndqgvievyekvrtekkatkrlieiikettasgqyrvivihgnapek
    aeelrqhlldfglgsdvslatfgsvigthlgagsialgyipvi