PDB entry 6dkb

View 6dkb on RCSB PDB site
Description: Crystal structure of Trk-A in complex with the Pan-Trk Kinase Inhibitor, compound 10b.
Class: transferase/transferase inhibitor
Keywords: Inhibitor Tyrosine kinase, TRANSFERASE, pan-Trk Kinase, Treatment for pain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-05-29, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1, MTC, TRK, TRKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dkba_
  • Heterogens: FKY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dkbA (A:)
    gstegkgsglqghiienpqyfsdacvhhikrrdivlkwelgegafgkvflaechnllpeq
    dkmlvavkalkeasesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgd
    lnrflrshgpdakllaggedvapgplglgqllavasqvaagmvylaglhfvhrdlatrnc
    lvgqglvvkigdfgmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvv
    lweiftygkqpwyqlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhsikd
    vharlqalaqappvyldvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dkbA (A:)
    cvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkeasesarqdfqre
    aelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpgplglgqllavasq
    vaagmvylaglhfvhrdlatrnclvgqglvvkigdfgstdyyrmlpirwmppesilyrkf
    ttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgrelerpracppevyaimrgcw
    qrepqqrhsikdvharlqalaqappvyldvlg