PDB entry 6dk3

View 6dk3 on RCSB PDB site
Description: HUMAN MITOCHONDRIAL SERINE HYDROXYMETHYLTRANSFERASe 2
Class: transferase
Keywords: SHMT2, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2018-05-28, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SHMT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34897 (Start-487)
      • conflict (268)
    Domains in SCOPe 2.07: d6dk3a_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dk3A (A:)
    gqlvrmairaqhsnaaqtqtgeanrgwtgqeslsdsdpemwellqrekdrqcrglelias
    enfcsraalealgsclnnkysegypgkryyggaevvdeiellcqrraleafdldpaqwgv
    nvqpysgspanlavytallqphdrimgldlpdgghlthgymsdvkrisatsiffesmpyk
    lnpktglidynqlaltarlfrprliiagtsayarlidyarmrevcdevkahlladmahis
    glvaakvipspfkhadivtttthktlrgtrsglifyrkgvkavdpktgreipytfedrin
    favfpslqggphnhaiaavavalkqactpmfreyslqvlknaramadallergyslvsgg
    tdnhlvlvdlrpkgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqf
    reddfrrvvdfidegvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfaraf
    pmpgfdeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dk3A (A:)
    gwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegev
    vdeiellcqrraleafdldpaqwgvnvqpysgspanlavytallqphdrimgldpyklnp
    ktglidynqlaltarlfrprliiagtsayarlidyarmrevcdevkahlladmahisglv
    aakvipspfkhadivtttthktlrgtrsglifyrkgvkavdpgreipytfedrinfavfp
    slqggphnhaiaavavalkqactpmfreyslqvlknaramadallergyslvsggtdnhl
    vlvdlrpkgldgaraervlelvsitankntcpgdrsaitpgglrlgapaltsrqfreddf
    rrvvdfidegvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgf
    deh