PDB entry 6dja

View 6dja on RCSB PDB site
Description: zn-dependent 5/b/6 metallo-beta-lactamase from bacillus cereus
Class: hydrolase
Keywords: hydrolase, zinc, lactamase
Deposited on 2018-05-24, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6djaa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6djaA (A:)
    hkviknetgtisisqlnknvwvhtelgyfsgeavpsnglvlntskglvlvdsswddkltk
    eliemvekkfkkrvtdviithahadriggmktlkergikahstaltaelakkngyeeplg
    dlqsvtnlkfgnmkvetfypgkghtednivvwlpqyqilaggclvksasskdlgnvaday
    vnewstsienvlkrygninlvvpghgevgdrglllhtldllk