PDB entry 6dj9

View 6dj9 on RCSB PDB site
Description: Structure of the USP15 DUSP domain in complex with a high-affinity Ubiquitin Variant (UbV)
Class: signaling protein
Keywords: deubiquitination, Ubv, high-affinity, strand-exchange, dimerization, SIGNALING PROTEIN
Deposited on 2018-05-24, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dj9a_
  • Chain 'B':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dj9b_
  • Chain 'C':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dj9c_
  • Chain 'D':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dj9d_
  • Chain 'E':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dj9e_
  • Chain 'F':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dj9f_
  • Chain 'G':
    Compound: Ubiquitin Variant UbV 15.D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DJ9
    Domains in SCOPe 2.07: d6dj9g_
  • Chain 'H':
    Compound: Ubiquitin Variant UbV 15.D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DJ9
    Domains in SCOPe 2.07: d6dj9h_
  • Chain 'I':
    Compound: Ubiquitin Variant UbV 15.D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DJ9
    Domains in SCOPe 2.07: d6dj9i_
  • Chain 'J':
    Compound: Ubiquitin Variant UbV 15.D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DJ9
    Domains in SCOPe 2.07: d6dj9j_
  • Chain 'K':
    Compound: Ubiquitin Variant UbV 15.D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DJ9
    Domains in SCOPe 2.07: d6dj9k_
  • Chain 'L':
    Compound: Ubiquitin Variant UbV 15.D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DJ9
    Domains in SCOPe 2.07: d6dj9l_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dj9A (A:)
    gaaamaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmg
    dqnvypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiark
    vveqgmfvkhckvevyltssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9A (A:)
    eggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvyp
    gpidnsgllkdgdqslkehlideldyillptegwnklvswytlmegqepiarkvveqgmf
    vkhckvevylt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dj9B (B:)
    gaaamaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmg
    dqnvypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiark
    vveqgmfvkhckvevyltssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9B (B:)
    aadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpi
    dnsgldgslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkhckve
    vyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dj9C (C:)
    gaaamaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmg
    dqnvypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiark
    vveqgmfvkhckvevyltssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9C (C:)
    adldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpid
    nsglkdgqslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkhckv
    evy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dj9D (D:)
    gaaamaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmg
    dqnvypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiark
    vveqgmfvkhckvevyltssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9D (D:)
    aadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpi
    dnsglslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkhckvevy
    lt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dj9E (E:)
    gaaamaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmg
    dqnvypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiark
    vveqgmfvkhckvevyltssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9E (E:)
    aadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpi
    dnsgllkdqslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkhck
    vevylt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dj9F (F:)
    gaaamaeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmg
    dqnvypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiark
    vveqgmfvkhckvevyltssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9F (F:)
    aeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvy
    pgpidnsgllkdaqslkehlideldyillptegwnklvswytlmegqepiarkvveqgmf
    vkhckvevylt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dj9G (G:)
    gagmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkesglqlhrrlrptsgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9G (G:)
    gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkesglqlhrrlr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6dj9H (H:)
    gagmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkesglqlhrrlrptsgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9H (H:)
    gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkesglqlhrrlrp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6dj9I (I:)
    gagmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkesglqlhrrlrptsgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9I (I:)
    gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkesglqlhrrlrp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6dj9J (J:)
    gagmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkesglqlhrrlrptsgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9J (J:)
    mqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkesglqlhrrlrp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6dj9K (K:)
    gagmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkesglqlhrrlrptsgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9K (K:)
    gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkesglqlhrrlr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6dj9L (L:)
    gagmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdyniqkesglqlhrrlrptsgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dj9L (L:)
    gmqifvstawfcgklitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
    dyniqkesglqlhrrlrp