PDB entry 6diu

View 6diu on RCSB PDB site
Description: Crystal structure of HCV NS3/4A protease in complex with P4-3(AJ-74)
Class: HYDROLASE/HYDROLASE Inhibitor
Keywords: NS3/4a Protease, Hepatitis C virus, Drug Resistance, Protease inhibitor, HYDROLASE-HYDROLASE Inhibitor complex, HYDROLASE
Deposited on 2018-05-23, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 protease
    Species: Hepacivirus C [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0B4WYC6 (22-198)
      • expression tag (0-21)
      • conflict (31-32)
      • conflict (35-36)
      • conflict (39)
      • conflict (65)
      • conflict (70)
      • conflict (90)
      • conflict (104)
      • conflict (177)
    Domains in SCOPe 2.07: d6diua1, d6diua2
  • Heterogens: GKM, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6diuA (A:)
    hmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatq
    tflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgs
    sdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifraavstr
    gvakavdfipveslettmr