PDB entry 6din

View 6din on RCSB PDB site
Description: High resolutionstructure of apo dTDP-4-dehydrorhamnose 3,5-epimerase
Class: isomerase
Keywords: epimerase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, NIAID, CSGID, ISOMERASE
Deposited on 2018-05-23, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: rmlC, rfbC, CAZ03_15755, HV91_29470, PAERUG_E15_London_28_01_14_02405, RW109_RW109_06764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dina1, d6dina2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dinA (A:)
    snamkatrlaipdvilfeprvfgddrgfffesynqrafeeacghpvsfvqdnhsrsargv
    lrglhyqirqaqgklvratlgevfdvavdlrrgsptfgqwvgerlsaenkrqmwipagfa
    hgfvvlseyaeflykttdfwapehercivwndpelkidwplqdapllsekdrqgkafada
    dcfp