PDB entry 6dik

View 6dik on RCSB PDB site
Description: Crystal structure of Bothropstoxin I (BthTX-I) complexed to Chicoric acid
Class: toxin
Keywords: Bothropd jararacussu, BthTX-I, Inhibitor, Chicoric Acid, Cichoric Acid, PLA2, TOXIN
Deposited on 2018-05-23, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90249 (0-120)
      • conflict (57)
    Domains in SCOPe 2.07: d6dika_
  • Chain 'B':
    Compound: Basic phospholipase A2 homolog bothropstoxin-1
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90249 (0-120)
      • conflict (57)
    Domains in SCOPe 2.07: d6dikb_
  • Heterogens: GKP, SO4, BCT, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dikA (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dikB (B:)
    slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c