PDB entry 6di3

View 6di3 on RCSB PDB site
Description: crystal structure of btk in complex with fragment ligand
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: LEAD OPTIMIZATION, FRAGMENT SCREENING BY X-RAY, TRANSFERASE, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2018-05-22, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6di3a_
  • Heterogens: GJA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6di3A (A:)
    glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >6di3A (A:)
    gsweidpkdltflkelgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
    eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
    kqflhrdlaarnclvndqgvvkvsdfglsryvlskfpvrwsppevlmyskfssksdiwaf
    gvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhekaderpt
    fkillsnildvmdees