PDB entry 6di1

View 6di1 on RCSB PDB site
Description: crystal structure of btk in complex with covalent fragment ligand
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: LEAD OPTIMIZATION, FRAGMENT SCREENING BY X-RAY, TRANSFERASE, TRANSFERASE-TRANSFERASE inhibitor complex
Deposited on 2018-05-22, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6di1a_
  • Heterogens: GJD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6di1A (A:)
    glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmdees