PDB entry 6di0

View 6di0 on RCSB PDB site
Description: crystal structure of btk in complex with fragment ligand
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: LEAD OPTIMIZATION, FRAGMENT SCREENING BY X-RAY, TRANSFERASE, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2018-05-22, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Gene: BTK, AGMX1, ATK, BPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6di0a_
  • Heterogens: GJG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6di0A (A:)
    glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
    mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
    meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
    lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
    imyscwhekaderptfkillsnildvmdees