PDB entry 6dhy

View 6dhy on RCSB PDB site
Description: Crystallogrpahic tetramer of Zn-bound RIDC1 variant bearing two disulfide bonded cysteines
Class: electron transport
Keywords: 4-helix bundle, engineered protein, metalloprotein, ELECTRON TRANSPORT
Deposited on 2018-05-21, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dhya_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dhyb_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dhyc_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d6dhyd_
  • Heterogens: HEM, CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhyA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhyB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhyC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhyD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr